PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02893.1.p
Common NameEUGRSUZ_C02893, LOC104437757
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 1045aa    MW: 114206 Da    PI: 4.8957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02893.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-183783148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  Eucgr.C02893.1.p 37 KGQWTAEEDEILRKAVERFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                      799****************************9.************986 PP

2Myb_DNA-binding66.45.1e-2189135148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+W++eEde++v++v+++G++ W+tIa++++ gR +kqc++rw+++l
  Eucgr.C02893.1.p  89 KGPWSKEEDEIIVELVNKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 135
                       79******************************.*************97 PP

3Myb_DNA-binding48.61.9e-15141183145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
  Eucgr.C02893.1.p 141 KEAWTQEEELALIRAHQIYGNR-WAELTKFLP-GRTDNAIKNHWN 183
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.3273283IPR017930Myb domain
SuperFamilySSF466891.0E-153389IPR009057Homeodomain-like
SMARTSM007171.9E-153685IPR001005SANT/Myb domain
PfamPF002491.0E-153783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-243995IPR009057Homeodomain-like
CDDcd001672.21E-144083No hitNo description
PROSITE profilePS5129433.35784139IPR017930Myb domain
SuperFamilySSF466898.99E-3286182IPR009057Homeodomain-like
SMARTSM007171.1E-1988137IPR001005SANT/Myb domain
PfamPF002493.8E-1989135IPR001005SANT/Myb domain
CDDcd001673.26E-1791135No hitNo description
Gene3DG3DSA:1.10.10.603.5E-2896139IPR009057Homeodomain-like
SMARTSM007172.2E-15140188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-21140190IPR009057Homeodomain-like
PROSITE profilePS5129419.563140190IPR017930Myb domain
PfamPF002491.8E-13141184IPR001005SANT/Myb domain
CDDcd001674.80E-12143183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1045 aa     Download sequence    Send to blast
MESERTASAP SDGSRDGVPR ARPLHGRTSG PTRRSTKGQW TAEEDEILRK AVERFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII VELVNKYGPK KWSTIAQHLP  120
GRIGKQCRER WHNHLNPAIN KEAWTQEEEL ALIRAHQIYG NRWAELTKFL PGRTDNAIKN  180
HWNSSVKKKL DTYLASGLLA QFPALPHVGF QNQLVASSSS RLQTSGVDTG NKCGVEPEEN  240
SECSQSSTVG CSQSTNDMAV GIPKNEESAL GRDHNSSPVS CSEQYYPSMD DVNLAIPDVH  300
PEICGSSNLV HHDFSCGNET SLEDYKFSGH DLPNSSFLDF GPESSGAKTE SIGASESHGG  360
LNVPFQTSLA LMVPSVGSLG IGADQLHQIL ISDDECCRFL FSDAMADESL SSENIAKESI  420
RTDVGGCIDA LISQSSNFQL SESSQLYDPS GAVAVDTSCA QPSNSAPLLF SSDGDAPVSG  480
SKTSQYPSFD TQEDFETGMH SCFVIADNSA NSPCDNGMSP GMLEQLELPP DQSKLVPVNA  540
FGSGSDVMQT TPSKAGPGIG AFKQEPGSLC YEPPRFPSLD IPFFSCDLIQ PTNDMQQEYS  600
PLGIRQLMMS SINCISPFRL WDSPSRDKSP DAVLKSAAKT FTSTPSILKK RCRDLLSPLS  660
DRRIDKKLEK DITSDLTRDF SRLDVMFDEA DTQRAYMLSP LIGMERNLMN RAEDKENSCI  720
GSECRQEKND RSGLPGNKSL EDDCSRDNYM KEEQQTVNDD IKAKTGVEAD ATTESVPEPP  780
DVLTEHDIND LLLFSPYQTS NQAHKATGST DETPRRQSSQ VVAPSLTHGV NFESSSGNSC  840
QPLSSPASEA KRGSHKVAKS TLSLPSGPLE ITVDNALNDA SFENSSIFGG TPFRRIIESP  900
SAWKSPWFIN SFLPGPRIST EITVEDIGYF MSPGDRSYDA LGLMKHLSEQ SAATFATAQE  960
VLGNDTPETV SKKKNLNHQN PDQENCKSKQ QMENCSSMGS ALPVERRTLD FSECGTPGKP  1020
KENGKSSIAM SFSSPSSYLL KGCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-72371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-72371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C02893.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010049083.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A059CTK70.0A0A059CTK7_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4